PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H00983.1.p
Common NameLOC105954974, MIMGU_mgv1a008153mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family ZF-HD
Protein Properties Length: 384aa    MW: 41956.6 Da    PI: 9.5204
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H00983.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.56.6e-33157212359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       +vrY+eClkNhAas+Ggh+vDGCgEfmps g+++++++l+CaAC+CHRnFHR+e e 
  Migut.H00983.1.p 157 SVRYRECLKNHAASMGGHVVDGCGEFMPS-GDDASPESLRCAACNCHRNFHRKEAEG 212
                       69**************************9.8889*******************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.3E-30158210IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-22158217IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.3E-31159209IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.225160209IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.98E-20304378IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-29312378IPR009057Homeodomain-like
PROSITE profilePS500718.503315379IPR001356Homeobox domain
TIGRFAMsTIGR015651.6E-26317374IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MERRSSQERR DTHTAAAVGM ANSISYGGQD SPVKLPLAPI LSTPPDHHRR GTISMLSTRR  60
GSSIFSPTLT LDHHHHHFNN PPPPPQHHRQ LSPPAPLVQL LQQPLVNEEY SSPDPDPPPP  120
TSTPTTAAAA AASNSNNLAV TPPPPPPPHQ QQQIEGSVRY RECLKNHAAS MGGHVVDGCG  180
EFMPSGDDAS PESLRCAACN CHRNFHRKEA EGQLLQTHHP AYLNPNSTNN NNHRSALFHG  240
SQLPSSAPPP PPPHHHLTKH TLTNSQGFAA RPPTMVNFGG NSGGTAAESS SEDLNMFHSS  300
GGGHNTTTGG PVPPSFKKRF RTKFSQNQKD RMQEFASKIG WRMQKQDEKE VQQFCNEVGV  360
KRQVFKVWMH NNKQSIKKTT QSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-213183751875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834116.10.0PREDICTED: zinc-finger homeodomain protein 6
RefseqXP_012834117.10.0PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A022RJ010.0A0A022RJ01_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000090332e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-61homeobox protein 24